DOG-1 (DOG1.1), CF740 conjugate, 0.1mg/mL

Catalog number BNC740725-100

Price for BNC740725-100

Size / count 1x 100 µL

About this product

Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.Primary antibodies are available purified, or with a selection of fluorescent CF® Dyes and other labels. CF® Dyes offer exceptional brightness and photostability. Note: Conjugates of blue fluorescent dyes like CF®405S and CF®405M are not recommended for detecting low abundance targets, because blue dyes have lower fluorescence and can give higher non-specific background than other dye colors.

Specifications

Catalog number: BNC740725-100
Size / count: 1x 100 µL
Dry ice: No
Hazardous: No
Discontinued: No
CAS Number: 9007-83-4
Synonyms: Anoctamin 1; Calcium Activated Chloride Channel; Discovered On Gastrointestinal Stromal Tumors Protein 1; TAOS2; ORAOV2; TMEM16A
UNSPSC: 41116161
UNSPSC Description: Primary and secondary antibodies for multiple methodology immunostaining detection application
Gene Name: TMEM16A
Gene ID: 55107
NCBI Gene ID: 503074
UniProt: Q5XXA6
Swiss Prot: Q5XXA6
Host: Mouse
Species Reactivity: Human
Reactivity: DOG-1|TMEM16A
Immunogen: A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein.
Target Antigen: DOG-1 | TMEM16A
Clonality: Monoclonal
Clone: DOG1.1
Type: Primary
Source: Animal
Origin: Animal
Applications: IHC, FFPE (verified)
Field of Research: Cancer
Positive Control: Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
Stability: 2 years
Concentration: 0.1 mg/mL
Buffer: PBS, 0.1% rBSA, 0.05% azide
Molecular Weight: ~114 kDa
Shipping Conditions: RT (ND)
Storage Conditions: Stable at room temperature or 37°C (98°F) for 7 days.
Notes: Protect from light
Shelf Life: Guaranteed for at least 24 months from date of receipt when stored as recommended
Fragment: IgG1, kappa
Species: Mus musculus (mouse), Bos taurus (bovine)
Classification: 0.05% sodium azide (CAS 26628-22-8)
Conjugate: CF740

Frequently Asked Questions

What is the catalog number for DOG-1 (DOG1.1), CF740 conjugate, 0.1mg/mL?

The catalog number for DOG-1 (DOG1.1), CF740 conjugate, 0.1mg/mL is BNC740725-100.

What sizes are available for DOG-1 (DOG1.1), CF740 conjugate, 0.1mg/mL?

DOG-1 (DOG1.1), CF740 conjugate, 0.1mg/mL is available in the following size(s): 1x 100 µL.

Is DOG-1 (DOG1.1), CF740 conjugate, 0.1mg/mL in stock?

DOG-1 (DOG1.1), CF740 conjugate, 0.1mg/mL is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures DOG-1 (DOG1.1), CF740 conjugate, 0.1mg/mL?

DOG-1 (DOG1.1), CF740 conjugate, 0.1mg/mL is manufactured by Biotium.

What is the estimated delivery time for DOG-1 (DOG1.1), CF740 conjugate, 0.1mg/mL?

Estimated delivery time for DOG-1 (DOG1.1), CF740 conjugate, 0.1mg/mL is approximately 15 business day(s), depending on your location.

Where can I find the safety data sheet (SDS/MSDS) for DOG-1 (DOG1.1), CF740 conjugate, 0.1mg/mL?

The safety data sheet for DOG-1 (DOG1.1), CF740 conjugate, 0.1mg/mL is available here: https://cdn.gentaur.com/products/37/68dd02a6061270361e105d1e/msds/bnc740725-100.pdf.

What is DOG-1 (DOG1.1), CF740 conjugate, 0.1mg/mL used for?

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.