SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag, Carrier-free

Catalog number RCOV03-carrier-free

Discontinued

Price for RCOV03-carrier-free

Size / count 100 µg

This variant is discontinued and cannot be added to your cart.

About this product

SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag is produced in E. coli and has a theoretical molecular weight of 13.2KD. This product is for research use only. Product is under validation for additional applications and indications. If you're interested, please contact support@bosterbio.com.

Specifications

Catalog number: RCOV03-carrier-free
Size / count: 100 µg
Dry ice: No
Hazardous: No
Discontinued: Yes
Synonyms: SARS-CoV-2, COVID-19, 2019-nCov, coronavirus, NSP9, Nonstructural Protein 9
Reactivity: Mouse
Source: E. coli
Sequence: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Purification: > 90%. Purification measurement method by SDS-PAGE quantitative densitometry by Coomassie? Blue Staining.<br>Method of purification: Nickel column affinity purification
Endotoxin: Less than 1 EU/μg protein as determined by LAL method.
Form: Lyophilized
Components: Lyophilized from sterile 20mM PB, 150mM NaCl, PH 7.3-7.4, 10% glycerol and 4% trehalose
Storage Conditions: The product is shipped at ambient temperature. Upon receipt, store it immediately at -20℃ for 6 months under sterile conditions. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Calculated Molecular Weight: 13.2KD

Frequently Asked Questions

What is the catalog number for SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag, Carrier-free?

The catalog number for SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag, Carrier-free is RCOV03-carrier-free.

Is SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag, Carrier-free in stock?

SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag, Carrier-free is currently made to order / not held in immediate stock. Contact us for lead time.

Where can I find the safety data sheet (SDS/MSDS) for SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag, Carrier-free?

The safety data sheet for SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag, Carrier-free is available here: https://www.bosterbio.com/msds?sku=RCOV03.

What is SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag, Carrier-free used for?

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

All Products