Recombinant Mouse IL-2

Catalog number 6496

Discontinued

Price for 6496

Size / count 5 µg

This variant is discontinued and cannot be added to your cart.

About this product

Interleukin-2 (IL-2) is a cytokine produced by T-helper cells in response to antigenic or mitogenic stimulation. It is required for T-cell proliferation and other activities crucial to the regulation of the immune response. Mouse IL-2 Recombinant Protein is purified interleukin-2 produced in yeast.

Specifications

Catalog number: 6496
Size / count: 5 µg
Dry ice: No
Hazardous: No
Discontinued: Yes
Synonyms: Mouse ; IL-2
Label: ICT
Type: Recombinant Protein
Source: Yeast
Sequence: APTSSSTSSPTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKLPRMLTF KFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGSDN TFECQFDDESATVVDFLRRWIAFCQSIISTSPQ (153)
Assay Protocol: The Mouse TNF alpha protein can be used in cell culture, as a TNF alpha ELISA Standard, and as a Western Blot Control.
Form: Lyophilized
Shipping Conditions: Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority Shipping
Storage Temperature: -20°C
Notes: 20% discount
Calculated Molecular Weight: 17.6 kDa
Target Description: Interleukin-2 (IL-2) is a cytokine produced by T-helper cells in response to antigenic or mitogenic stimulation. It is required for T-cell proliferation and other activities crucial to the regulation of the immune response., , IL-2 was discovered to be a member of a family of cytokines, which also includes IL-4, IL-7, IL-9, IL-15 and IL-21. IL-2 signals through a receptor complex consisting of IL-2 specific IL-2 receptor alpha (CD25), IL-2 receptor beta (CD122) and a common gamma chain (γc). All members of this family use the common gamma chain as part of their signaling complex.

Frequently Asked Questions

What is the catalog number for Recombinant Mouse IL-2?

The catalog number for Recombinant Mouse IL-2 is 6496.

Is Recombinant Mouse IL-2 in stock?

Recombinant Mouse IL-2 is currently made to order / not held in immediate stock. Contact us for lead time.

What is Recombinant Mouse IL-2 used for?

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

All Products