Recombinant Mouse IL-10

Catalog number 6503

Discontinued

Price for 6503

Size / count 5 µg

This variant is discontinued and cannot be added to your cart.

About this product

IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which have indispensable functions in many infectious and inflammatory diseases. Mouse IL-10 Recombinant Protein is purified interleukin-10 produced in yeast.

Specifications

Catalog number: 6503
Size / count: 5 µg
Dry ice: No
Hazardous: No
Discontinued: Yes
Synonyms: Mouse ;IL-10
Label: ICT
Type: Recombinant Protein
Source: Yeast
Sequence: SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYL GCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKA VEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (160)
Assay Protocol: The Mouse IFN gamma protein can be used in cell culture, as an IFN gamma ELISA Standard, and as a Western Blot Control.
Form: Lyophilized
Shipping Conditions: Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority Shipping
Storage Temperature: -20°C
Notes: 20% discount
Calculated Molecular Weight: 18.8 kDa
Target Description: IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which consists of nine members: IL-10, IL-19, IL-20, IL-22, IL-24, IL-26, IL-28A, IL-28B, and IL-29. These cytokines elicit diverse host defense mechanisms., , IL-10 family cytokines have indispensable functions in many infectious and inflammatory diseases. IL-10 family cytokines are essential for maintaining the integrity and homeostasis of tissue epithelial layers. By promoting innate immune response, members of this family can limit the damage caused by viral and bacterial infections. They can also facilitate the tissue-healing process in injuries caused by infection or inflammation.

Frequently Asked Questions

What is the catalog number for Recombinant Mouse IL-10?

The catalog number for Recombinant Mouse IL-10 is 6503.

Is Recombinant Mouse IL-10 in stock?

Recombinant Mouse IL-10 is currently made to order / not held in immediate stock. Contact us for lead time.

What is Recombinant Mouse IL-10 used for?

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

All Products