Recombinant Rat APRIL

Catalog number 6505

Discontinued

Price for 6505

Size / count 5 µg

This variant is discontinued and cannot be added to your cart.

About this product

A proliferation-inducing ligand (APRIL), also known as TNFSF13, is a member of the tumor necrosis factor (TNF) ligand superfamily. APRIL/TNFSF13 has been shown to play a role in protecting cells from undergoing apoptosis and promoting B cell development. Rat APRIL Recombinant Protein is purified APRIL (TNFSF13) produced in yeast.

Specifications

Catalog number: 6505
Size / count: 5 µg
Dry ice: No
Hazardous: No
Discontinued: Yes
Synonyms: Rat ; April
Label: ICT
Type: Recombinant Protein
Source: Yeast
Sequence: AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYL LYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDI ITVKIPRANAKLSLSPHGTFLGFVKL (146)
Assay Protocol: The Mouse FGF basic protein can be used in cell culture, as a FGF basic ELISA Standard, and as a Western Blot Control.
Form: Lyophilized
Shipping Conditions: Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority Shipping
Storage Temperature: -20°C
Notes: 20% discount
Calculated Molecular Weight: 16.4 kDa
Target Description: A proliferation-inducing ligand (APRIL), also known as TNFSF13, is a member of the tumor necrosis factor (TNF) ligand superfamily. Nineteen cytokine ligands have been identified as part of the TNF family on the basis of sequence, functional, and structural similarities. Family members include TNF beta (TNFSF1), TNF alpha (TNFSF2), Lymphotoxin beta (TNFSF3), OX40 Ligand (TNFSF4), CD40 Ligand (TNFSF5), Fas Ligand (TNFSF6), CD27 Ligand (TNFSF7), CD30 Ligand (TNFSF8), 4-1BB Ligand (TNFSF9), TRAIL (TNFSF10), TRANCE/RANKL (TNFSF11), TWEAK (TNFSF12), APRIL(TNFSF13), BAFF (TNFSF13B), LIGHT (TNFSF14), TL1A/VEGI (TNFSF15), and GITR Ligand (TNFSF18)., , The TNFSF13 ligand (APRIL) is expressed by macrophages and dendritic cells. APRIL/TNFSF13 has been shown to play a role in protecting cells from undergoing apoptosis and promoting B cell development.

Frequently Asked Questions

What is the catalog number for Recombinant Rat APRIL?

The catalog number for Recombinant Rat APRIL is 6505.

Is Recombinant Rat APRIL in stock?

Recombinant Rat APRIL is currently made to order / not held in immediate stock. Contact us for lead time.

What is Recombinant Rat APRIL used for?

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

All Products