G-CSF Antibody (HRP)

Catalog number KH-062-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-062-01

Size / count 50 μL

Specifications

Catalog number: KH-062-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Granulocyte colony-stimulating factor, G-CSF, Pluripoietin, Filgrastim, Lenograstim
Gene Name: CSF3
Gene ID: 1440
UniProt: P09919
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CSF3
Target: P00197PC
Partner Proteins: Granulocyte colony-stimulating factor; G-CSF; Pluripoietin; Filgrastim; Lenograstim
Clone: KT27
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 74%, Pig - 78%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: QSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 74%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: C17orf33; GCSF
Target Alternative Name: G-CSF
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: Colony stimulating factor 3
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for G-CSF Antibody (HRP)?

The catalog number for G-CSF Antibody (HRP) is KH-062.

What sizes are available for G-CSF Antibody (HRP)?

G-CSF Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does G-CSF Antibody (HRP) come in?

G-CSF Antibody (HRP) is available in 3 different pack sizes.

Is G-CSF Antibody (HRP) in stock?

G-CSF Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

All Products