Product details

Anti-MBP Tag Antibody

Catalog number KC-2177-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2177-01

Size / count 50 μL

Specifications

Catalog number: KC-2177-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Maltose/maltodextrin-binding periplasmic protein, MMBP, Maltodextrin-binding protein, Maltose-binding protein, MBP
Gene Name: MalE
UniProt: P0AEX9
Antigen Species: Strain K12
Cross Reactivity: Not tested
Immunogen: A protein antigen containing MBP tag
Target: P02515PA
Partner Proteins: Maltose/maltodextrin-binding periplasmic protein; MMBP; Maltodextrin-binding protein; Maltose-binding protein; MBP
Clone: K06169_1A3
Conjugation: Unconjugated
Applications: Top_IP/ChIP&Top_WB
Validation: Top_IP/ChIP&Top_WB
Purity: ≥85%
Cores: GKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: MBP Tag
Panel Description: Tag&Loading Control
Host or Source: Mouse
Protein Name: Maltose/maltodextrin-binding periplasmic protein
WB Description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Anti-MBP Tag Antibody?

The catalog number for Anti-MBP Tag Antibody is KC-2177.

What sizes are available for Anti-MBP Tag Antibody?

Anti-MBP Tag Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Anti-MBP Tag Antibody come in?

Anti-MBP Tag Antibody is available in 3 different pack sizes.

Is Anti-MBP Tag Antibody in stock?

Anti-MBP Tag Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.