Phospholipase A2 Activator Protein Antibody

Catalog number KC-1714-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1714-01

Size / count 50 μL

Specifications

Catalog number: KC-1714-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Phospholipase A-2-activating protein, PLA2P, PLAP
Gene Name: PLAA
Gene ID: 9373
UniProt: Q9Y263
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PLAA
Target: PP-5571
Partner Proteins: Phospholipase A-2-activating protein; PLA2P; PLAP
Clone: K06278_10H5
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 95%, Rat - 94%, Pig - 96%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: EDRTASAEEIKAFEKELSHATIDSKTGDLGDINAEQLPGREHLNEPGTREGQTRLIRDGEKVEAYQWSVSEGRWIKIGDVVGSSGANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQML
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 95%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: PLAP
Target Alternative Name: Phospholipase A2 Activator Protein
Panel Description: Neuroscience Biomarkers, Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Phospholipase A2 activating protein
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Phospholipase A2 Activator Protein Antibody?

The catalog number for Phospholipase A2 Activator Protein Antibody is KC-1714.

What sizes are available for Phospholipase A2 Activator Protein Antibody?

Phospholipase A2 Activator Protein Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Phospholipase A2 Activator Protein Antibody come in?

Phospholipase A2 Activator Protein Antibody is available in 3 different pack sizes.

Is Phospholipase A2 Activator Protein Antibody in stock?

Phospholipase A2 Activator Protein Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

All Products