- Catalog number
- KC-405-01
- Size / count
- 50 μL
- Dry ice
- No
- Hazardous
- No
- Discontinued
- No
- Product Name Alternative
- Interleukin-8, IL-8, C-X-C motif chemokine 8, Chemokine, C-X-C motif) ligand 8, Emoctakin, Granulocyte chemotactic protein 1, GCP-1, Monocyte-derived neutrophil chemotactic factor, MDNCF, Monocyte-derived neutrophil-activating peptide, MONAP, Neutrophil-activating protein 1, NAP-1, Protein 3-10C, T-cell chemotactic factor) [Cleaved into: MDNCF-a, GCP/IL-8 protein IV, IL8/NAP1 form I, Interleukin-8, (Ala-IL-8) 77, GCP/IL-8 protein II, IL-8 (1-77), IL8/NAP1 form II, MDNCF-b, IL-8 (5-77, IL-8 (6-77, (Ser-IL-8) 72, GCP/IL-8 protein I, IL8/NAP1 form III, Lymphocyte-derived neutrophil-activating factor, LYNAP, MDNCF-c, Neutrophil-activating factor, NAF, IL-8 (7-77, GCP/IL-8 protein V, IL8/NAP1 form IV, IL-8 (8-77, GCP/IL-8 protein VI, IL8/NAP1 form V, IL-8 (9-77, GCP/IL-8 protein III, IL8/NAP1 form VI]
- Gene Name
- CXCL8
- Gene ID
- 3576
- UniProt
- P10145
- Antigen Species
- Human
- Reactivity
- Human
- Cross Reactivity
- KT212 does not cross-react with IL1B, IL2, IL4, IL5, IL6, IL7, IL9, IL10, IL11, IL12, IL13, IL17A, CSF2, IFNA, IFNG, CCL2, KITLG and TNF
- Immunogen
- Recombinant human CXCL8
- Target
- PP-530
- Partner Proteins
- Interleukin-8; IL-8; C-X-C motif chemokine 8; Chemokine; C-X-C motif) ligand 8; Emoctakin; Granulocyte chemotactic protein 1; GCP-1; Monocyte-derived neutrophil chemotactic factor; MDNCF; Monocyte-derived neutrophil-activating peptide; MONAP; Neutrophil-activating protein 1; NAP-1; Protein 3-10C; T-cell chemotactic factor) [Cleaved into: MDNCF-a; GCP/IL-8 protein IV; IL8/NAP1 form I; Interleukin-8; (Ala-IL-8) 77; GCP/IL-8 protein II; IL-8 (1-77) ; IL8/NAP1 form II; MDNCF-b; IL-8 (5-77; IL-8 (6-77; (Ser-IL-8) 72; GCP/IL-8 protein I; IL8/NAP1 form III; Lymphocyte-derived neutrophil-activating factor; LYNAP; MDNCF-c; Neutrophil-activating factor; NAF; IL-8 (7-77; GCP/IL-8 protein V; IL8/NAP1 form IV; IL-8 (8-77; GCP/IL-8 protein VI; IL8/NAP1 form V; IL-8 (9-77; GCP/IL-8 protein III; IL8/NAP1 form VI]
- Clone
- KT212
- Conjugation
- Unconjugated
- Applications
- WB&ELISA
- Validation
- WB&ELISA
- Detection Method
- Succeed
- Homology
- Highest antigen sequence identity to the following orthologs: Mouse - 53%, Rat - 52%, Pig - 76%, Cynomolgus monkey - 96%
- Purity
- ≥85%
- Cores
- ELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVE
- Storage Temperature
- Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
- Identity Mouse
- 53%
- Recombinant Antibody
- Not recombinant
- WB Dilution
- 1:1000
- Sandwich ELISA Dilution
- 1:250~1:500
- Formulation
- Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
- Antibody Type
- Monoclonal
- Gene Name Synonym
- IL8
- Target Alternative Name
- CXCL8
- Panel Description
- Cytokines, Ferroptosis
- Host or Source
- Mouse
- Protein Name
- C-X-C motif chemokine ligand 8
- WB Description
- Succeed
- Shipping Temperature
- Shipped at ambient temperature or with ice packs.
- Isotype
- IgG1
