Product details

IL8/CXCL8 Antibody

Catalog number KC-406-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-406-01

Size / count 50 μL

Specifications

Catalog number: KC-406-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interleukin-8, IL-8, C-X-C motif chemokine 8, Chemokine, C-X-C motif) ligand 8, Emoctakin, Granulocyte chemotactic protein 1, GCP-1, Monocyte-derived neutrophil chemotactic factor, MDNCF, Monocyte-derived neutrophil-activating peptide, MONAP, Neutrophil-activating protein 1, NAP-1, Protein 3-10C, T-cell chemotactic factor) [Cleaved into: MDNCF-a, GCP/IL-8 protein IV, IL8/NAP1 form I, Interleukin-8, (Ala-IL-8) 77, GCP/IL-8 protein II, IL-8 (1-77), IL8/NAP1 form II, MDNCF-b, IL-8 (5-77, IL-8 (6-77, (Ser-IL-8) 72, GCP/IL-8 protein I, IL8/NAP1 form III, Lymphocyte-derived neutrophil-activating factor, LYNAP, MDNCF-c, Neutrophil-activating factor, NAF, IL-8 (7-77, GCP/IL-8 protein V, IL8/NAP1 form IV, IL-8 (8-77, GCP/IL-8 protein VI, IL8/NAP1 form V, IL-8 (9-77, GCP/IL-8 protein III, IL8/NAP1 form VI]
Gene Name: CXCL8
Gene ID: 3576
UniProt: P10145
Antigen Species: Human
Reactivity: Human
Cross Reactivity: KT213 does not cross-react with human IL1B, IL2, IL4, IL5, IL6, IL7, IL9, IL10, IL11, IL12, IL13, IL17A, CSF2, IFNA, IFNG, CCL2, KITLG and TNF
Immunogen: Recombinant human CXCL8
Target: PP-530
Partner Proteins: Interleukin-8; IL-8; C-X-C motif chemokine 8; Chemokine; C-X-C motif) ligand 8; Emoctakin; Granulocyte chemotactic protein 1; GCP-1; Monocyte-derived neutrophil chemotactic factor; MDNCF; Monocyte-derived neutrophil-activating peptide; MONAP; Neutrophil-activating protein 1; NAP-1; Protein 3-10C; T-cell chemotactic factor) [Cleaved into: MDNCF-a; GCP/IL-8 protein IV; IL8/NAP1 form I; Interleukin-8; (Ala-IL-8) 77; GCP/IL-8 protein II; IL-8 (1-77) ; IL8/NAP1 form II; MDNCF-b; IL-8 (5-77; IL-8 (6-77; (Ser-IL-8) 72; GCP/IL-8 protein I; IL8/NAP1 form III; Lymphocyte-derived neutrophil-activating factor; LYNAP; MDNCF-c; Neutrophil-activating factor; NAF; IL-8 (7-77; GCP/IL-8 protein V; IL8/NAP1 form IV; IL-8 (8-77; GCP/IL-8 protein VI; IL8/NAP1 form V; IL-8 (9-77; GCP/IL-8 protein III; IL8/NAP1 form VI]
Clone: KT213
Conjugation: Unconjugated
Applications: Top_WB&ELISA
Validation: Top_WB&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 53%, Rat - 52%, Pig - 76%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: ELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 53%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: IL8
Target Alternative Name: CXCL8
Panel Description: Cytokines, Ferroptosis
Host or Source: Mouse
Protein Name: C-X-C motif chemokine ligand 8
WB Description: Succeed
IHC description: Fail (Tonsil)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for IL8/CXCL8 Antibody?

The catalog number for IL8/CXCL8 Antibody is KC-406.

What sizes are available for IL8/CXCL8 Antibody?

IL8/CXCL8 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does IL8/CXCL8 Antibody come in?

IL8/CXCL8 Antibody is available in 3 different pack sizes.

Is IL8/CXCL8 Antibody in stock?

IL8/CXCL8 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.