IL8/CXCL8 Antibody (HRP)

Catalog number KH-406-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-406-01

Size / count 50 μL

Specifications

Catalog number: KH-406-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interleukin-8, IL-8, C-X-C motif chemokine 8, Chemokine, C-X-C motif) ligand 8, Emoctakin, Granulocyte chemotactic protein 1, GCP-1, Monocyte-derived neutrophil chemotactic factor, MDNCF, Monocyte-derived neutrophil-activating peptide, MONAP, Neutrophil-activating protein 1, NAP-1, Protein 3-10C, T-cell chemotactic factor) [Cleaved into: MDNCF-a, GCP/IL-8 protein IV, IL8/NAP1 form I, Interleukin-8, (Ala-IL-8) 77, GCP/IL-8 protein II, IL-8 (1-77), IL8/NAP1 form II, MDNCF-b, IL-8 (5-77, IL-8 (6-77, (Ser-IL-8) 72, GCP/IL-8 protein I, IL8/NAP1 form III, Lymphocyte-derived neutrophil-activating factor, LYNAP, MDNCF-c, Neutrophil-activating factor, NAF, IL-8 (7-77, GCP/IL-8 protein V, IL8/NAP1 form IV, IL-8 (8-77, GCP/IL-8 protein VI, IL8/NAP1 form V, IL-8 (9-77, GCP/IL-8 protein III, IL8/NAP1 form VI]
Gene Name: CXCL8
Gene ID: 3576
UniProt: P10145
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CXCL8
Target: PP-530
Partner Proteins: Interleukin-8; IL-8; C-X-C motif chemokine 8; Chemokine; C-X-C motif) ligand 8; Emoctakin; Granulocyte chemotactic protein 1; GCP-1; Monocyte-derived neutrophil chemotactic factor; MDNCF; Monocyte-derived neutrophil-activating peptide; MONAP; Neutrophil-activating protein 1; NAP-1; Protein 3-10C; T-cell chemotactic factor) [Cleaved into: MDNCF-a; GCP/IL-8 protein IV; IL8/NAP1 form I; Interleukin-8; (Ala-IL-8) 77; GCP/IL-8 protein II; IL-8 (1-77) ; IL8/NAP1 form II; MDNCF-b; IL-8 (5-77; IL-8 (6-77; (Ser-IL-8) 72; GCP/IL-8 protein I; IL8/NAP1 form III; Lymphocyte-derived neutrophil-activating factor; LYNAP; MDNCF-c; Neutrophil-activating factor; NAF; IL-8 (7-77; GCP/IL-8 protein V; IL8/NAP1 form IV; IL-8 (8-77; GCP/IL-8 protein VI; IL8/NAP1 form V; IL-8 (9-77; GCP/IL-8 protein III; IL8/NAP1 form VI]
Clone: KT213
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 53%, Rat - 52%, Pig - 76%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: ELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 53%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: IL8
Target Alternative Name: CXCL8
Panel Description: Cytokines, Ferroptosis
Host or Source: Mouse
Protein Name: C-X-C motif chemokine ligand 8
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for IL8/CXCL8 Antibody (HRP)?

The catalog number for IL8/CXCL8 Antibody (HRP) is KH-406.

What sizes are available for IL8/CXCL8 Antibody (HRP)?

IL8/CXCL8 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does IL8/CXCL8 Antibody (HRP) come in?

IL8/CXCL8 Antibody (HRP) is available in 3 different pack sizes.

Is IL8/CXCL8 Antibody (HRP) in stock?

IL8/CXCL8 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.