Product details

IL8/CXCL8 Antibody

Catalog number KC-060-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-060-01

Size / count 50 μL

Specifications

Catalog number: KC-060-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interleukin-8, IL-8, C-X-C motif chemokine 8, Chemokine, C-X-C motif) ligand 8, Emoctakin, Granulocyte chemotactic protein 1, GCP-1, Monocyte-derived neutrophil chemotactic factor, MDNCF, Monocyte-derived neutrophil-activating peptide, MONAP, Neutrophil-activating protein 1, NAP-1, Protein 3-10C, T-cell chemotactic factor) [Cleaved into: MDNCF-a, GCP/IL-8 protein IV, IL8/NAP1 form I, Interleukin-8, (Ala-IL-8) 77, GCP/IL-8 protein II, IL-8 (1-77), IL8/NAP1 form II, MDNCF-b, IL-8 (5-77, IL-8 (6-77, (Ser-IL-8) 72, GCP/IL-8 protein I, IL8/NAP1 form III, Lymphocyte-derived neutrophil-activating factor, LYNAP, MDNCF-c, Neutrophil-activating factor, NAF, IL-8 (7-77, GCP/IL-8 protein V, IL8/NAP1 form IV, IL-8 (8-77, GCP/IL-8 protein VI, IL8/NAP1 form V, IL-8 (9-77, GCP/IL-8 protein III, IL8/NAP1 form VI]
Gene Name: CXCL8
Gene ID: 3576
UniProt: P10145
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CXCL8
Target: PP-530
Partner Proteins: Interleukin-8; IL-8; C-X-C motif chemokine 8; Chemokine; C-X-C motif) ligand 8; Emoctakin; Granulocyte chemotactic protein 1; GCP-1; Monocyte-derived neutrophil chemotactic factor; MDNCF; Monocyte-derived neutrophil-activating peptide; MONAP; Neutrophil-activating protein 1; NAP-1; Protein 3-10C; T-cell chemotactic factor) [Cleaved into: MDNCF-a; GCP/IL-8 protein IV; IL8/NAP1 form I; Interleukin-8; (Ala-IL-8) 77; GCP/IL-8 protein II; IL-8 (1-77) ; IL8/NAP1 form II; MDNCF-b; IL-8 (5-77; IL-8 (6-77; (Ser-IL-8) 72; GCP/IL-8 protein I; IL8/NAP1 form III; Lymphocyte-derived neutrophil-activating factor; LYNAP; MDNCF-c; Neutrophil-activating factor; NAF; IL-8 (7-77; GCP/IL-8 protein V; IL8/NAP1 form IV; IL-8 (8-77; GCP/IL-8 protein VI; IL8/NAP1 form V; IL-8 (9-77; GCP/IL-8 protein III; IL8/NAP1 form VI]
Clone: K06289_9F3
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB&ELISA
Validation: Top_IHC&Top_WB&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 53%, Rat - 52%, Pig - 76%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: ELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 53%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:250~1:500
WB Dilution: 1:1000
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: IL8
Target Alternative Name: CXCL8
Panel Description: Cytokines, Ferroptosis
Host or Source: Mouse
Protein Name: C-X-C motif chemokine ligand 8
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for IL8/CXCL8 Antibody?

The catalog number for IL8/CXCL8 Antibody is KC-060.

What sizes are available for IL8/CXCL8 Antibody?

IL8/CXCL8 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does IL8/CXCL8 Antibody come in?

IL8/CXCL8 Antibody is available in 3 different pack sizes.

Is IL8/CXCL8 Antibody in stock?

IL8/CXCL8 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.