Product details

Anti-Human IgG2 Antibody

Catalog number KC-427-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-427-01

Size / count 50 μL

Specifications

Catalog number: KC-427-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Immunoglobulin heavy constant gamma 2, Ig gamma-2 chain C region, Ig gamma-2 chain C region DOT, Ig gamma-2 chain C region TIL, Ig gamma-2 chain C region ZIE
Gene Name: IGHG2
Gene ID: 3501
UniProt: P01859
Antigen Species: Human
Reactivity: Human
Cross Reactivity: K06302_19F4 does not cross-react with human IgG1, IgG3, IgG4, IgA, IgM and IgE
Immunogen: Recombinant human IgG2
Target: PP-515
Partner Proteins: Immunoglobulin heavy constant gamma 2; Ig gamma-2 chain C region; Ig gamma-2 chain C region DOT; Ig gamma-2 chain C region TIL; Ig gamma-2 chain C region ZIE
Clone: K06302_19F4
Conjugation: Unconjugated
Applications: Top_IHC&ELISA
Validation: Top_IHC&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 65%, Rat - 64%, Pig - 73%, Cynomolgus monkey - 86%
Purity: ≥85%
Cores: KCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 65%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:1000
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Human IgG2
Panel Description: Immunoglobulin
Host or Source: Mouse
Protein Name: Immunoglobulin heavy constant gamma 2
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Anti-Human IgG2 Antibody?

The catalog number for Anti-Human IgG2 Antibody is KC-427.

What sizes are available for Anti-Human IgG2 Antibody?

Anti-Human IgG2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Anti-Human IgG2 Antibody come in?

Anti-Human IgG2 Antibody is available in 3 different pack sizes.

Is Anti-Human IgG2 Antibody in stock?

Anti-Human IgG2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.