Product details

Anti-Human IgG2 Antibody

Catalog number KC-429-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-429-01

Size / count 50 μL

Specifications

Catalog number: KC-429-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Immunoglobulin heavy constant gamma 2, Ig gamma-2 chain C region, Ig gamma-2 chain C region DOT, Ig gamma-2 chain C region TIL, Ig gamma-2 chain C region ZIE
Gene Name: IGHG2
Gene ID: 3501
UniProt: P01859
Antigen Species: Human
Reactivity: Human
Cross Reactivity: K06302_22C5 does not cross-react with human IgG1, IgG3, IgG4, IgA, IgM and IgE
Immunogen: Recombinant human IgG2
Target: PP-515
Partner Proteins: Immunoglobulin heavy constant gamma 2; Ig gamma-2 chain C region; Ig gamma-2 chain C region DOT; Ig gamma-2 chain C region TIL; Ig gamma-2 chain C region ZIE
Clone: K06306_22C5
Conjugation: Unconjugated
Applications: IHC&ELISA
Validation: IHC&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 65%, Rat - 64%, Pig - 73%, Cynomolgus monkey - 86%
Purity: ≥85%
Cores: KCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 65%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:500
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Human IgG2
Panel Description: Immunoglobulin
Host or Source: Mouse
Protein Name: Immunoglobulin heavy constant gamma 2
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for Anti-Human IgG2 Antibody?

The catalog number for Anti-Human IgG2 Antibody is KC-429.

What sizes are available for Anti-Human IgG2 Antibody?

Anti-Human IgG2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Anti-Human IgG2 Antibody come in?

Anti-Human IgG2 Antibody is available in 3 different pack sizes.

Is Anti-Human IgG2 Antibody in stock?

Anti-Human IgG2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

All Products