Human IgG2 Antibody (HRP)

Catalog number KH-429-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-429-01

Size / count 50 μL

Specifications

Catalog number: KH-429-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Immunoglobulin heavy constant gamma 2, Ig gamma-2 chain C region, Ig gamma-2 chain C region DOT, Ig gamma-2 chain C region TIL, Ig gamma-2 chain C region ZIE
Gene Name: IGHG2
Gene ID: 3501
UniProt: P01859
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IgG2
Target: PP-515
Partner Proteins: Immunoglobulin heavy constant gamma 2; Ig gamma-2 chain C region; Ig gamma-2 chain C region DOT; Ig gamma-2 chain C region TIL; Ig gamma-2 chain C region ZIE
Clone: K06306_22C5
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 65%, Rat - 64%, Pig - 73%, Cynomolgus monkey - 86%
Purity: ≥85%
Cores: KCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 65%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Human IgG2
Panel Description: Immunoglobulin
Host or Source: Mouse
Protein Name: Immunoglobulin heavy constant gamma 2
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for Human IgG2 Antibody (HRP)?

The catalog number for Human IgG2 Antibody (HRP) is KH-429.

What sizes are available for Human IgG2 Antibody (HRP)?

Human IgG2 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Human IgG2 Antibody (HRP) come in?

Human IgG2 Antibody (HRP) is available in 3 different pack sizes.

Is Human IgG2 Antibody (HRP) in stock?

Human IgG2 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.