IL33 Antibody (HRP)

Catalog number KH-2675-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-2675-01

Size / count 50 μL

Specifications

Catalog number: KH-2675-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interleukin-33, IL-33, Interleukin-1 family member 11, IL-1F11, Nuclear factor from high endothelial venules, NF-HEV) [Cleaved into: Interleukin-33, 95-270, Interleukin-33, 99-270, Interleukin-33, 109-270]
Gene Name: IL33
Gene ID: 90865
UniProt: O95760
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IL33
Target: PP-11920
Partner Proteins: Interleukin-33; IL-33; Interleukin-1 family member 11; IL-1F11; Nuclear factor from high endothelial venules; NF-HEV) [Cleaved into: Interleukin-33; 95-270; Interleukin-33; 99-270; Interleukin-33; 109-270]
Clone: K06316_12E5
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 62%, Rat - 62%, Pig - 74%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: DQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 62%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: C9orf26; IL1F11; NFHEV
Target Alternative Name: IL33
Panel Description: Cytokines, Ferroptosis
Host or Source: Mouse
Protein Name: Interleukin 33
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for IL33 Antibody (HRP)?

The catalog number for IL33 Antibody (HRP) is KH-2675.

What sizes are available for IL33 Antibody (HRP)?

IL33 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does IL33 Antibody (HRP) come in?

IL33 Antibody (HRP) is available in 3 different pack sizes.

Is IL33 Antibody (HRP) in stock?

IL33 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

All Products