Product details

SIRP alpha Antibody

Catalog number KC-1074-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1074-01

Size / count 50 μL

Specifications

Catalog number: KC-1074-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Tyrosine-protein phosphatase non-receptor type substrate 1, SHP substrate 1, SHPS-1, Brain Ig-like molecule with tyrosine-based activation motifs, Bit, CD172 antigen-like family member A, Inhibitory receptor SHPS-1, Macrophage fusion receptor, MyD-1 antigen, Signal-regulatory protein alpha-1, Sirp-alpha-1, Signal-regulatory protein alpha-2, Sirp-alpha-2, Signal-regulatory protein alpha-3, Sirp-alpha-3, p84, CD antigen CD172a
Gene Name: SIRPA
Gene ID: 140885
UniProt: P78324
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SIRPA
Target Antigen: CD172a
Target: PP-817
Partner Proteins: Tyrosine-protein phosphatase non-receptor type substrate 1; SHP substrate 1; SHPS-1; Brain Ig-like molecule with tyrosine-based activation motifs; Bit; CD172 antigen-like family member A; Inhibitory receptor SHPS-1; Macrophage fusion receptor; MyD-1 antigen; Signal-regulatory protein alpha-1; Sirp-alpha-1; Signal-regulatory protein alpha-2; Sirp-alpha-2; Signal-regulatory protein alpha-3; Sirp-alpha-3; p84; CD antigen CD172a
Clone: K06318_5H9
Conjugation: Unconjugated
Applications: Top_IHC&Top_IP/ChIP&Top_WB
Validation: Top_IHC&Top_IP/ChIP&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 79%, Rat - 81%, Pig - 85%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: AQGSTSSTRLHEPEKNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 79%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
WB Dilution: 1:1000
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: BIT; MFR; MYD1; PTPNS1; SHPS1; SIRP
Target Alternative Name: SIRP alpha
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Signal regulatory protein alpha
WB Description: Succeed
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for SIRP alpha Antibody?

The catalog number for SIRP alpha Antibody is KC-1074.

What sizes are available for SIRP alpha Antibody?

SIRP alpha Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does SIRP alpha Antibody come in?

SIRP alpha Antibody is available in 3 different pack sizes.

Is SIRP alpha Antibody in stock?

SIRP alpha Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.