Product details

Tissue Factor Antibody

Catalog number KC-997-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-997-01

Size / count 50 μL

Specifications

Catalog number: KC-997-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Tissue factor, TF, Coagulation factor III, Thromboplastin, CD antigen CD142
Gene Name: F3
Gene ID: 2152
UniProt: P13726
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human F3
Target Antigen: CD142
Target: PP-1084
Partner Proteins: Tissue factor; TF; Coagulation factor III; Thromboplastin; CD antigen CD142
Clone: K06319_4H12
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 55%, Rat - 54%, Pig - 70%, Cynomolgus monkey - 93%
Purity: ≥85%
Cores: LTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 55%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
WB Dilution: 1:500~1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Tissue Factor
Panel Description: Cytokines, CD Antigen
Host or Source: Mouse
Protein Name: Coagulation factor III, tissue factor
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Tissue Factor Antibody?

The catalog number for Tissue Factor Antibody is KC-997.

What sizes are available for Tissue Factor Antibody?

Tissue Factor Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Tissue Factor Antibody come in?

Tissue Factor Antibody is available in 3 different pack sizes.

Is Tissue Factor Antibody in stock?

Tissue Factor Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.