Interferon gamma Receptor 1 Antibody

Catalog number KC-1108-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1108-01

Size / count 50 μL

Specifications

Catalog number: KC-1108-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interferon gamma receptor 1, IFN-gamma receptor 1, IFN-gamma-R1, CDw119, Interferon gamma receptor alpha-chain, IFN-gamma-R-alpha, CD antigen CD119
Gene Name: IFNGR1
Gene ID: 3459
UniProt: P15260
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IFNGR1
Target Antigen: CD119
Target: PP-1127
Partner Proteins: Interferon gamma receptor 1; IFN-gamma receptor 1; IFN-gamma-R1; CDw119; Interferon gamma receptor alpha-chain; IFN-gamma-R-alpha; CD antigen CD119
Clone: K06319_6A9
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 60%, Pig - 59%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: IILPKSLISVVRSATLETKPESKYVSLITSYQPFSLEKEVVCEEPLSPATVPGMHTEDNPGKVEHTEELSSITEVVTTEE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 60%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Interferon gamma Receptor 1
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Interferon gamma receptor 1
WB Description: Fail (Hep G2)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Interferon gamma Receptor 1 Antibody?

The catalog number for Interferon gamma Receptor 1 Antibody is KC-1108.

What sizes are available for Interferon gamma Receptor 1 Antibody?

Interferon gamma Receptor 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Interferon gamma Receptor 1 Antibody come in?

Interferon gamma Receptor 1 Antibody is available in 3 different pack sizes.

Is Interferon gamma Receptor 1 Antibody in stock?

Interferon gamma Receptor 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

All Products