Tissue Factor Antibody

Catalog number KC-887-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-887-01

Size / count 50 μL

Specifications

Catalog number: KC-887-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Tissue factor, TF, Coagulation factor III, Thromboplastin, CD antigen CD142
Gene Name: F3
Gene ID: 2152
UniProt: P13726
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human F3
Target Antigen: CD142
Target: PP-1084
Partner Proteins: Tissue factor; TF; Coagulation factor III; Thromboplastin; CD antigen CD142
Clone: K06319_7D2
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 55%, Rat - 54%, Pig - 70%, Cynomolgus monkey - 93%
Purity: ≥85%
Cores: LTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 55%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Tissue Factor
Panel Description: Cytokines, CD Antigen
Host or Source: Mouse
Protein Name: Coagulation factor III, tissue factor
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Tissue Factor Antibody?

The catalog number for Tissue Factor Antibody is KC-887.

What sizes are available for Tissue Factor Antibody?

Tissue Factor Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Tissue Factor Antibody come in?

Tissue Factor Antibody is available in 3 different pack sizes.

Is Tissue Factor Antibody in stock?

Tissue Factor Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

All Products