Tissue Factor Antibody

Catalog number KC-888-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-888-01

Size / count 50 μL

Specifications

Catalog number: KC-888-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Tissue factor, TF, Coagulation factor III, Thromboplastin, CD antigen CD142
Gene Name: F3
Gene ID: 2152
UniProt: P13726
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human F3
Target Antigen: CD142
Target: PP-1084
Partner Proteins: Tissue factor; TF; Coagulation factor III; Thromboplastin; CD antigen CD142
Clone: K06319_10G1
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 55%, Rat - 54%, Pig - 70%, Cynomolgus monkey - 93%
Purity: ≥85%
Cores: LTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 55%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Tissue Factor
Panel Description: Cytokines, CD Antigen
Host or Source: Mouse
Protein Name: Coagulation factor III, tissue factor
WB Description: Fail (A-431)
IHC description: Succeed
IP description: Fail (A-431)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Tissue Factor Antibody?

The catalog number for Tissue Factor Antibody is KC-888.

What sizes are available for Tissue Factor Antibody?

Tissue Factor Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Tissue Factor Antibody come in?

Tissue Factor Antibody is available in 3 different pack sizes.

Is Tissue Factor Antibody in stock?

Tissue Factor Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.