CD63 Antibody (HRP)

Catalog number KH-1387-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-1387-01

Size / count 50 μL

Specifications

Catalog number: KH-1387-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: CD63 antigen, Granulophysin, Lysosomal-associated membrane protein 3, LAMP-3, Lysosome integral membrane protein 1, Limp1, Melanoma-associated antigen ME491, OMA81H, Ocular melanoma-associated antigen, Tetraspanin-30, Tspan-30, CD antigen CD63, CD63 antigen, Granulophysin, Lysosomal-associated membrane protein 3, LAMP-3, Lysosome integral membrane protein 1, Limp1, Melanoma-associated antigen ME491, OMA81H, Ocular melanoma-associated antigen, Tetraspanin-30, Tspan-30, CD antigen CD63
Gene Name: CD63
UniProt: P08962-1
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CD63
Target Antigen: CD63, CD63
Target: P09869SA
Partner Proteins: CD63 antigen; Granulophysin; Lysosomal-associated membrane protein 3; LAMP-3; Lysosome integral membrane protein 1; Limp1; Melanoma-associated antigen ME491; OMA81H; Ocular melanoma-associated antigen; Tetraspanin-30; Tspan-30; CD antigen CD63
Clone: K06337_9C12
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 67%, Rat - 66%, Pig - 78%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: VMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLR
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 67%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: MLA1; TSPAN30
Target Alternative Name: CD63
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: CD63 molecule, CD63 antigen
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for CD63 Antibody (HRP)?

The catalog number for CD63 Antibody (HRP) is KH-1387.

What sizes are available for CD63 Antibody (HRP)?

CD63 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CD63 Antibody (HRP) come in?

CD63 Antibody (HRP) is available in 3 different pack sizes.

Is CD63 Antibody (HRP) in stock?

CD63 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

All Products