T Cell Leukemia/Lymphoma Protein 1A Antibody

Catalog number KC-2053-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2053-01

Size / count 50 μL

Specifications

Catalog number: KC-2053-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: T-cell leukemia/lymphoma protein 1A, Oncogene TCL-1, Oncogene TCL1, Protein p14 TCL1
Gene Name: TCL1A
Gene ID: 8115
UniProt: P56279
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TCL1A
Target: PP-3438
Partner Proteins: T-cell leukemia/lymphoma protein 1A; Oncogene TCL-1; Oncogene TCL1; Protein p14 TCL1
Clone: K06347_19D12
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 58%, Pig - 56%, Cynomolgus monkey - 88%
Purity: ≥85%
Cores: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 58%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: TCL1
Target Alternative Name: T Cell Leukemia/Lymphoma Protein 1A
Panel Description: IHC Pathology
Host or Source: Mouse
Protein Name: TCL1 family AKT coactivator A
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for T Cell Leukemia/Lymphoma Protein 1A Antibody?

The catalog number for T Cell Leukemia/Lymphoma Protein 1A Antibody is KC-2053.

What sizes are available for T Cell Leukemia/Lymphoma Protein 1A Antibody?

T Cell Leukemia/Lymphoma Protein 1A Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does T Cell Leukemia/Lymphoma Protein 1A Antibody come in?

T Cell Leukemia/Lymphoma Protein 1A Antibody is available in 3 different pack sizes.

Is T Cell Leukemia/Lymphoma Protein 1A Antibody in stock?

T Cell Leukemia/Lymphoma Protein 1A Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

All Products