VEGFD Antibody (HRP)

Catalog number KH-2688-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-2688-01

Size / count 50 μL

Specifications

Catalog number: KH-2688-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Vascular endothelial growth factor D, VEGF-D, c-Fos-induced growth factor, FIGF
Gene Name: VEGFD
Gene ID: 2277
UniProt: O43915
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human VEGFD
Target: PQ-146
Partner Proteins: Vascular endothelial growth factor D; VEGF-D; c-Fos-induced growth factor; FIGF
Clone: K06356_17D1
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 95%, Pig - 93%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: VIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPY
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: FIGF
Target Alternative Name: VEGFD
Panel Description: IHC Pathology
Host or Source: Mouse
Protein Name: Vascular endothelial growth factor D
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for VEGFD Antibody (HRP)?

The catalog number for VEGFD Antibody (HRP) is KH-2688.

What sizes are available for VEGFD Antibody (HRP)?

VEGFD Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does VEGFD Antibody (HRP) come in?

VEGFD Antibody (HRP) is available in 3 different pack sizes.

Is VEGFD Antibody (HRP) in stock?

VEGFD Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

All Products