Product details

Anti-Human IgG1 Antibody

Catalog number KC-1616-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1616-01

Size / count 50 μL

Specifications

Catalog number: KC-1616-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Immunoglobulin heavy constant gamma 1, Ig gamma-1 chain C region, Ig gamma-1 chain C region EU, Ig gamma-1 chain C region KOL, Ig gamma-1 chain C region NIE
Gene Name: IGHG1
Gene ID: 3500
UniProt: P01857
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IgG1 Fc fusion protein
Target: PP-1638
Partner Proteins: Immunoglobulin heavy constant gamma 1; Ig gamma-1 chain C region; Ig gamma-1 chain C region EU; Ig gamma-1 chain C region KOL; Ig gamma-1 chain C region NIE
Clone: K16105_1D5
Conjugation: Unconjugated
Applications: Top_WB&ELISA
Validation: Top_WB&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 70%, Rat - 72%, Pig - 81%, Cynomolgus monkey - 93%
Purity: ≥85%
Cores: PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 70%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Human IgG1
Panel Description: IHC Pathology, Immunoglobulin
Host or Source: Mouse
Protein Name: Immunoglobulin heavy constant gamma 1 (G1m marker)
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Anti-Human IgG1 Antibody?

The catalog number for Anti-Human IgG1 Antibody is KC-1616.

What sizes are available for Anti-Human IgG1 Antibody?

Anti-Human IgG1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Anti-Human IgG1 Antibody come in?

Anti-Human IgG1 Antibody is available in 3 different pack sizes.

Is Anti-Human IgG1 Antibody in stock?

Anti-Human IgG1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

All Products