Product details

Band 3/AE 1 Antibody

Catalog number KC-592-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-592-01

Size / count 50 μL

Specifications

Catalog number: KC-592-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Band 3 anion transport protein, Anion exchange protein 1, AE 1, Anion exchanger 1, Solute carrier family 4 member 1, CD antigen CD233
Gene Name: SLC4A1
Gene ID: 6521
UniProt: P02730
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SLC4A1
Target Antigen: CD233
Target: PP-4225
Partner Proteins: Band 3 anion transport protein; Anion exchange protein 1; AE 1; Anion exchanger 1; Solute carrier family 4 member 1; CD antigen CD233
Clone: K16256_5E10
Conjugation: Unconjugated
Applications: Top_IHC&Top_IP/ChIP
Validation: Top_IHC&Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 69%, Rat - 69%, Pig - 63%, Cynomolgus monkey - 89%
Purity: ≥85%
Cores: MMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYKGLDLNGGPDD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 69%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:1000
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: AE1; DI; EPB3
Target Alternative Name: Band 3/AE 1
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Solute carrier family 4 member 1 (Diego blood group)
WB Description: Fail (K-562, MOLT-4, HL-60, A549)
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Band 3/AE 1 Antibody?

The catalog number for Band 3/AE 1 Antibody is KC-592.

What sizes are available for Band 3/AE 1 Antibody?

Band 3/AE 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Band 3/AE 1 Antibody come in?

Band 3/AE 1 Antibody is available in 3 different pack sizes.

Is Band 3/AE 1 Antibody in stock?

Band 3/AE 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

All Products