Carbonic Anhydrase 1 Antibody

Catalog number KC-1867-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1867-01

Size / count 50 μL

Specifications

Catalog number: KC-1867-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Carbonic anhydrase 1, Carbonate dehydratase I, Carbonic anhydrase B, CAB, Carbonic anhydrase I, CA-I, Cyanamide hydratase CA1
Gene Name: CA1
Gene ID: 759
UniProt: P00915
Antigen Species: Human
Reactivity: Human, Rat
Cross Reactivity: Not tested
Immunogen: Recombinant human CA1
Target: PP-052
Partner Proteins: Carbonic anhydrase 1; Carbonate dehydratase I; Carbonic anhydrase B; CAB; Carbonic anhydrase I; CA-I; Cyanamide hydratase CA1
Clone: K16257_2B9
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 78%, Rat - 81%, Pig - 83%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: KNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRAS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 78%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Carbonic Anhydrase 1
Host or Source: Mouse
Protein Name: Carbonic anhydrase 1
WB Description: Succeed
IP description: Fail (Rat Spleen)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Carbonic Anhydrase 1 Antibody?

The catalog number for Carbonic Anhydrase 1 Antibody is KC-1867.

What sizes are available for Carbonic Anhydrase 1 Antibody?

Carbonic Anhydrase 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Carbonic Anhydrase 1 Antibody come in?

Carbonic Anhydrase 1 Antibody is available in 3 different pack sizes.

Is Carbonic Anhydrase 1 Antibody in stock?

Carbonic Anhydrase 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.