Carbonic Anhydrase 1 Antibody

Catalog number KC-1866-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1866-01

Size / count 50 μL

Specifications

Catalog number: KC-1866-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Carbonic anhydrase 1, Carbonate dehydratase I, Carbonic anhydrase B, CAB, Carbonic anhydrase I, CA-I, Cyanamide hydratase CA1
Gene Name: CA1
Gene ID: 759
UniProt: P00915
Antigen Species: Human
Reactivity: Human, Rat
Cross Reactivity: Not tested
Immunogen: Recombinant human CA1
Target: PP-052
Partner Proteins: Carbonic anhydrase 1; Carbonate dehydratase I; Carbonic anhydrase B; CAB; Carbonic anhydrase I; CA-I; Cyanamide hydratase CA1
Clone: K16257_10H9
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 78%, Rat - 81%, Pig - 83%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: KNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRAS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 78%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Carbonic Anhydrase 1
Host or Source: Mouse
Protein Name: Carbonic anhydrase 1
WB Description: Succeed
IP description: Fail (Rat Spleen)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Carbonic Anhydrase 1 Antibody?

The catalog number for Carbonic Anhydrase 1 Antibody is KC-1866.

What sizes are available for Carbonic Anhydrase 1 Antibody?

Carbonic Anhydrase 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Carbonic Anhydrase 1 Antibody come in?

Carbonic Anhydrase 1 Antibody is available in 3 different pack sizes.

Is Carbonic Anhydrase 1 Antibody in stock?

Carbonic Anhydrase 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

All Products