RNA Polymerase II Subunit B1 Antibody — image 1 of 2

Product details

RNA Polymerase II Subunit B1 Antibody

Catalog number KC-1168-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1168-01

Size / count 50 μL

Specifications

Catalog number: KC-1168-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: DNA-directed RNA polymerase II subunit RPB1, RNA polymerase II subunit B1, DNA-directed RNA polymerase II subunit A, DNA-directed RNA polymerase III largest subunit, RNA-directed RNA polymerase II subunit RPB1
Gene Name: POLR2A
Gene ID: 5430
UniProt: P24928
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human POLR2A
Target: PP-764
Partner Proteins: DNA-directed RNA polymerase II subunit RPB1; RNA polymerase II subunit B1; DNA-directed RNA polymerase II subunit A; DNA-directed RNA polymerase III largest subunit; RNA-directed RNA polymerase II subunit RPB1
Clone: K16265_3B8
Conjugation: Unconjugated
Applications: Top_WB&ELISA
Validation: Top_WB&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: IAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: POLR2
Target Alternative Name: RNA Polymerase II Subunit B1
Host or Source: Mouse
Protein Name: RNA polymerase II subunit A
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for RNA Polymerase II Subunit B1 Antibody?

The catalog number for RNA Polymerase II Subunit B1 Antibody is KC-1168.

What sizes are available for RNA Polymerase II Subunit B1 Antibody?

RNA Polymerase II Subunit B1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does RNA Polymerase II Subunit B1 Antibody come in?

RNA Polymerase II Subunit B1 Antibody is available in 3 different pack sizes.

Is RNA Polymerase II Subunit B1 Antibody in stock?

RNA Polymerase II Subunit B1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

All Products