Product details

Peroxiredoxin-5 Antibody

Catalog number KC-1126-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1126-01

Size / count 50 μL

Specifications

Catalog number: KC-1126-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Peroxiredoxin-5, mitochondrial, Alu corepressor 1, Antioxidant enzyme B166, AOEB166, Liver tissue 2D-page spot 71B, PLP, Peroxiredoxin V, Prx-V, Peroxisomal antioxidant enzyme, TPx type VI, Thioredoxin peroxidase PMP20, Thioredoxin-dependent peroxiredoxin 5
Gene Name: PRDX5
Gene ID: 25824
UniProt: P30044
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PRDX5
Target: PP-1484
Partner Proteins: Peroxiredoxin-5; mitochondrial; Alu corepressor 1; Antioxidant enzyme B166; AOEB166; Liver tissue 2D-page spot 71B; PLP; Peroxiredoxin V; Prx-V; Peroxisomal antioxidant enzyme; TPx type VI; Thioredoxin peroxidase PMP20; Thioredoxin-dependent peroxiredoxin 5
Clone: K16265_6D9
Conjugation: Unconjugated
Applications: Top_IHC&Top_IP/ChIP&Top_WB&ELISA
Validation: Top_IHC&Top_IP/ChIP&Top_WB&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 91%, Rat - 91%, Pig - 91%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: MAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 91%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
WB Dilution: 1:1000
IP Dilution: 1:100
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ACR1
Target Alternative Name: Peroxiredoxin-5
Host or Source: Mouse
Protein Name: Peroxiredoxin 5
WB Description: Succeed
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Peroxiredoxin-5 Antibody?

The catalog number for Peroxiredoxin-5 Antibody is KC-1126.

What sizes are available for Peroxiredoxin-5 Antibody?

Peroxiredoxin-5 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Peroxiredoxin-5 Antibody come in?

Peroxiredoxin-5 Antibody is available in 3 different pack sizes.

Is Peroxiredoxin-5 Antibody in stock?

Peroxiredoxin-5 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.