RNA Polymerase II Subunit B1 Antibody

Catalog number KC-1059-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1059-01

Size / count 50 μL

Specifications

Catalog number: KC-1059-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: DNA-directed RNA polymerase II subunit RPB1, RNA polymerase II subunit B1, DNA-directed RNA polymerase II subunit A, DNA-directed RNA polymerase III largest subunit, RNA-directed RNA polymerase II subunit RPB1
Gene Name: POLR2A
Gene ID: 5430
UniProt: P24928
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human POLR2A
Target: PP-764
Partner Proteins: DNA-directed RNA polymerase II subunit RPB1; RNA polymerase II subunit B1; DNA-directed RNA polymerase II subunit A; DNA-directed RNA polymerase III largest subunit; RNA-directed RNA polymerase II subunit RPB1
Clone: K16265_16D10
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: IAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: POLR2
Target Alternative Name: RNA Polymerase II Subunit B1
Host or Source: Mouse
Protein Name: RNA polymerase II subunit A
WB Description: Fail (HeLa)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for RNA Polymerase II Subunit B1 Antibody?

The catalog number for RNA Polymerase II Subunit B1 Antibody is KC-1059.

What sizes are available for RNA Polymerase II Subunit B1 Antibody?

RNA Polymerase II Subunit B1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does RNA Polymerase II Subunit B1 Antibody come in?

RNA Polymerase II Subunit B1 Antibody is available in 3 different pack sizes.

Is RNA Polymerase II Subunit B1 Antibody in stock?

RNA Polymerase II Subunit B1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

All Products