RNA Polymerase II Subunit B1 Antibody

Catalog number KC-1060-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1060-01

Size / count 50 μL

Specifications

Catalog number: KC-1060-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: DNA-directed RNA polymerase II subunit RPB1, RNA polymerase II subunit B1, DNA-directed RNA polymerase II subunit A, DNA-directed RNA polymerase III largest subunit, RNA-directed RNA polymerase II subunit RPB1
Gene Name: POLR2A
Gene ID: 5430
UniProt: P24928
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human POLR2A
Target: PP-764
Partner Proteins: DNA-directed RNA polymerase II subunit RPB1; RNA polymerase II subunit B1; DNA-directed RNA polymerase II subunit A; DNA-directed RNA polymerase III largest subunit; RNA-directed RNA polymerase II subunit RPB1
Clone: K16265_18G9
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: IAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: POLR2
Target Alternative Name: RNA Polymerase II Subunit B1
Host or Source: Mouse
Protein Name: RNA polymerase II subunit A
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for RNA Polymerase II Subunit B1 Antibody?

The catalog number for RNA Polymerase II Subunit B1 Antibody is KC-1060.

What sizes are available for RNA Polymerase II Subunit B1 Antibody?

RNA Polymerase II Subunit B1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does RNA Polymerase II Subunit B1 Antibody come in?

RNA Polymerase II Subunit B1 Antibody is available in 3 different pack sizes.

Is RNA Polymerase II Subunit B1 Antibody in stock?

RNA Polymerase II Subunit B1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.