RNA Polymerase II Subunit B1 Antibody — image 1 of 2

Product details

RNA Polymerase II Subunit B1 Antibody

Catalog number KC-1061-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1061-01

Size / count 50 μL

Specifications

Catalog number: KC-1061-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: DNA-directed RNA polymerase II subunit RPB1, RNA polymerase II subunit B1, DNA-directed RNA polymerase II subunit A, DNA-directed RNA polymerase III largest subunit, RNA-directed RNA polymerase II subunit RPB1
Gene Name: POLR2A
Gene ID: 5430
UniProt: P24928
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human POLR2A
Target: PP-764
Partner Proteins: DNA-directed RNA polymerase II subunit RPB1; RNA polymerase II subunit B1; DNA-directed RNA polymerase II subunit A; DNA-directed RNA polymerase III largest subunit; RNA-directed RNA polymerase II subunit RPB1
Clone: K16265_20D1
Conjugation: Unconjugated
Applications: Top_IHC&ELISA
Validation: Top_IHC&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: IAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: POLR2
Target Alternative Name: RNA Polymerase II Subunit B1
Host or Source: Mouse
Protein Name: RNA polymerase II subunit A
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for RNA Polymerase II Subunit B1 Antibody?

The catalog number for RNA Polymerase II Subunit B1 Antibody is KC-1061.

What sizes are available for RNA Polymerase II Subunit B1 Antibody?

RNA Polymerase II Subunit B1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does RNA Polymerase II Subunit B1 Antibody come in?

RNA Polymerase II Subunit B1 Antibody is available in 3 different pack sizes.

Is RNA Polymerase II Subunit B1 Antibody in stock?

RNA Polymerase II Subunit B1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.