MMP2 Antibody (HRP)

Catalog number KH-2683-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-2683-01

Size / count 50 μL

Specifications

Catalog number: KH-2683-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: 72 kDa type IV collagenase, 72 kDa gelatinase, Gelatinase A, Matrix metalloproteinase-2, MMP-2, TBE-1) [Cleaved into: PEX]
Gene Name: MMP2
Gene ID: 4313
UniProt: P08253
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human MMP2
Target: PQ-017
Partner Proteins: 72 kDa type IV collagenase; 72 kDa gelatinase; Gelatinase A; Matrix metalloproteinase-2; MMP-2; TBE-1) [Cleaved into: PEX]
Clone: K16288_19D1
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 97%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: CLG4A
Target Alternative Name: MMP2
Panel Description: Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: Matrix metallopeptidase 2
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for MMP2 Antibody (HRP)?

The catalog number for MMP2 Antibody (HRP) is KH-2683.

What sizes are available for MMP2 Antibody (HRP)?

MMP2 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does MMP2 Antibody (HRP) come in?

MMP2 Antibody (HRP) is available in 3 different pack sizes.

Is MMP2 Antibody (HRP) in stock?

MMP2 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.