HBEGF Antibody (HRP)

Catalog number KH-2686-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-2686-01

Size / count 50 μL

Specifications

Catalog number: KH-2686-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Proheparin-binding EGF-like growth factor [Cleaved into: Heparin-binding EGF-like growth factor, HB-EGF, HBEGF, Diphtheria toxin receptor, DT-R]
Gene Name: HBEGF
Gene ID: 1839
UniProt: Q99075
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human HBEGF
Target: PP-3105
Partner Proteins: Proheparin-binding EGF-like growth factor [Cleaved into: Heparin-binding EGF-like growth factor; HB-EGF; HBEGF; Diphtheria toxin receptor; DT-R]
Clone: K16295_3C2
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 73%, Rat - 76%, Pig - 93%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: LLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 73%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: DTR; DTS; HEGFL
Target Alternative Name: HBEGF
Host or Source: Mouse
Protein Name: Heparin binding EGF like growth factor
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for HBEGF Antibody (HRP)?

The catalog number for HBEGF Antibody (HRP) is KH-2686.

What sizes are available for HBEGF Antibody (HRP)?

HBEGF Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does HBEGF Antibody (HRP) come in?

HBEGF Antibody (HRP) is available in 3 different pack sizes.

Is HBEGF Antibody (HRP) in stock?

HBEGF Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

All Products