HBEGF Antibody (HRP)

Catalog number KH-2685-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-2685-01

Size / count 50 μL

Specifications

Catalog number: KH-2685-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Proheparin-binding EGF-like growth factor [Cleaved into: Heparin-binding EGF-like growth factor, HB-EGF, HBEGF, Diphtheria toxin receptor, DT-R]
Gene Name: HBEGF
Gene ID: 1839
UniProt: Q99075
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human HBEGF
Target: PP-3105
Partner Proteins: Proheparin-binding EGF-like growth factor [Cleaved into: Heparin-binding EGF-like growth factor; HB-EGF; HBEGF; Diphtheria toxin receptor; DT-R]
Clone: K16295_4B10
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 73%, Rat - 76%, Pig - 93%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: LLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 73%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: DTR; DTS; HEGFL
Target Alternative Name: HBEGF
Host or Source: Mouse
Protein Name: Heparin binding EGF like growth factor
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for HBEGF Antibody (HRP)?

The catalog number for HBEGF Antibody (HRP) is KH-2685.

What sizes are available for HBEGF Antibody (HRP)?

HBEGF Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does HBEGF Antibody (HRP) come in?

HBEGF Antibody (HRP) is available in 3 different pack sizes.

Is HBEGF Antibody (HRP) in stock?

HBEGF Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.