Calpain 1 Antibody

Catalog number KC-2707-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2707-01

Size / count 50 μL

Specifications

Catalog number: KC-2707-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Calpain-1 catalytic subunit, Calcium-activated neutral proteinase 1, CANP 1, Calpain mu-type, Calpain-1 large subunit, Cell proliferation-inducing gene 30 protein, Micromolar-calpain, muCANP
Gene Name: CAPN1
Gene ID: 823
UniProt: P07384
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CAPN1
Target: PP-4293
Partner Proteins: Calpain-1 catalytic subunit; Calcium-activated neutral proteinase 1; CANP 1; Calpain mu-type; Calpain-1 large subunit; Cell proliferation-inducing gene 30 protein; Micromolar-calpain; muCANP
Clone: K16303_20E11
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Rat - 87%, Pig - 94%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: FEPNKEGDFVLRFFSEKSAGTVELDDQIQANLPDEQVLSEEEIDENFKALFRQLAGEDMEISVKELRTILNRIISKHKDL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CANPL1
Target Alternative Name: Calpain 1
Host or Source: Mouse
Protein Name: Calpain 1
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Calpain 1 Antibody?

The catalog number for Calpain 1 Antibody is KC-2707.

What sizes are available for Calpain 1 Antibody?

Calpain 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Calpain 1 Antibody come in?

Calpain 1 Antibody is available in 3 different pack sizes.

Is Calpain 1 Antibody in stock?

Calpain 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.