Calpain 1 Antibody

Catalog number KC-3030-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-3030-01

Size / count 50 μL

Specifications

Catalog number: KC-3030-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Calpain-1 catalytic subunit, Calcium-activated neutral proteinase 1, CANP 1, Calpain mu-type, Calpain-1 large subunit, Cell proliferation-inducing gene 30 protein, Micromolar-calpain, muCANP
Gene Name: CAPN1
Gene ID: 823
UniProt: P07384
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CAPN1
Target: PP-4293
Partner Proteins: Calpain-1 catalytic subunit; Calcium-activated neutral proteinase 1; CANP 1; Calpain mu-type; Calpain-1 large subunit; Cell proliferation-inducing gene 30 protein; Micromolar-calpain; muCANP
Clone: K16303_20H3
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Rat - 87%, Pig - 94%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: FEPNKEGDFVLRFFSEKSAGTVELDDQIQANLPDEQVLSEEEIDENFKALFRQLAGEDMEISVKELRTILNRIISKHKDL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Not recombinant
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CANPL1
Target Alternative Name: Calpain 1
Host or Source: Mouse
Protein Name: Calpain 1
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Calpain 1 Antibody?

The catalog number for Calpain 1 Antibody is KC-3030.

What sizes are available for Calpain 1 Antibody?

Calpain 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Calpain 1 Antibody come in?

Calpain 1 Antibody is available in 3 different pack sizes.

Is Calpain 1 Antibody in stock?

Calpain 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.