IL17A Antibody (HRP)

Catalog number KH-3000-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-3000-01

Size / count 50 μL

Specifications

Catalog number: KH-3000-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interleukin-17A, IL-17, IL-17A, Cytotoxic T-lymphocyte-associated antigen 8, CTLA-8
Gene Name: IL17A
Gene ID: 3605
UniProt: Q16552
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IL17A
Target: PQ-368
Partner Proteins: Interleukin-17A; IL-17; IL-17A; Cytotoxic T-lymphocyte-associated antigen 8; CTLA-8
Clone: K1E007_1C3
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 62%, Rat - 60%, Pig - 75%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 62%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: CTLA8; IL17
Target Alternative Name: IL17A
Panel Description: Cytokines, Neuroscience Biomarkers, Ferroptosis
Host or Source: Mouse
Protein Name: Interleukin 17A
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for IL17A Antibody (HRP)?

The catalog number for IL17A Antibody (HRP) is KH-3000.

What sizes are available for IL17A Antibody (HRP)?

IL17A Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does IL17A Antibody (HRP) come in?

IL17A Antibody (HRP) is available in 3 different pack sizes.

Is IL17A Antibody (HRP) in stock?

IL17A Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.