IL17A Antibody (HRP)

Catalog number KH-2993-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-2993-01

Size / count 50 μL

Specifications

Catalog number: KH-2993-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interleukin-17A, IL-17, IL-17A, Cytotoxic T-lymphocyte-associated antigen 8, CTLA-8
Gene Name: IL17A
Gene ID: 3605
UniProt: Q16552
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IL17A
Target: PQ-368
Partner Proteins: Interleukin-17A; IL-17; IL-17A; Cytotoxic T-lymphocyte-associated antigen 8; CTLA-8
Clone: K1E007_7E4
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 62%, Rat - 60%, Pig - 75%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 62%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: CTLA8; IL17
Target Alternative Name: IL17A
Panel Description: Cytokines, Neuroscience Biomarkers, Ferroptosis
Host or Source: Mouse
Protein Name: Interleukin 17A
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for IL17A Antibody (HRP)?

The catalog number for IL17A Antibody (HRP) is KH-2993.

What sizes are available for IL17A Antibody (HRP)?

IL17A Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does IL17A Antibody (HRP) come in?

IL17A Antibody (HRP) is available in 3 different pack sizes.

Is IL17A Antibody (HRP) in stock?

IL17A Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.