Parathyroid Hormone Antibody

Catalog number KC-1761-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1761-01

Size / count 50 μL

Specifications

Catalog number: KC-1761-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Parathyroid hormone, PTH, Parathormone, Parathyrin
Gene Name: PTH
Gene ID: 5741
UniProt: P01270
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PTH
Target: PP-061
Partner Proteins: Parathyroid hormone; PTH; Parathormone; Parathyrin
Clone: K1E035_1E1
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Rat - 73%, Pig - 85%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: NLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Parathyroid Hormone
Panel Description: IHC Pathology
Host or Source: Mouse
Protein Name: Parathyroid hormone
WB Description: Fail (NIH/3T3)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Parathyroid Hormone Antibody?

The catalog number for Parathyroid Hormone Antibody is KC-1761.

What sizes are available for Parathyroid Hormone Antibody?

Parathyroid Hormone Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Parathyroid Hormone Antibody come in?

Parathyroid Hormone Antibody is available in 3 different pack sizes.

Is Parathyroid Hormone Antibody in stock?

Parathyroid Hormone Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.