Parathyroid Hormone Antibody

Catalog number KC-3225-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-3225-01

Size / count 50 μL

Specifications

Catalog number: KC-3225-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Parathyroid hormone, PTH, Parathormone, Parathyrin
Gene Name: PTH
Gene ID: 5741
UniProt: P01270
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PTH
Target: PP-061
Partner Proteins: Parathyroid hormone; PTH; Parathormone; Parathyrin
Clone: K1E035_13C4
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Rat - 73%, Pig - 85%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: NLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Parathyroid Hormone
Panel Description: IHC Pathology
Host or Source: Mouse
Protein Name: Parathyroid hormone
WB Description: Fail (Jurkat, NIH/3T3)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Parathyroid Hormone Antibody?

The catalog number for Parathyroid Hormone Antibody is KC-3225.

What sizes are available for Parathyroid Hormone Antibody?

Parathyroid Hormone Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Parathyroid Hormone Antibody come in?

Parathyroid Hormone Antibody is available in 3 different pack sizes.

Is Parathyroid Hormone Antibody in stock?

Parathyroid Hormone Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

All Products