Perilipin-1 Antibody

Catalog number KC-1754-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1754-01

Size / count 50 μL

Specifications

Catalog number: KC-1754-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Perilipin-1, Lipid droplet-associated protein
Gene Name: PLIN1
Gene ID: 5346
UniProt: O60240
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PLIN1
Target: PP-1227
Partner Proteins: Perilipin-1; Lipid droplet-associated protein
Clone: K1E037_8G8
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 96%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: DGDLPEQENVLQRVLQLPVVSGTCECFQKTYTSTKEAHPLVASVCNAYEKGVQSASSLAAWSMEPVVRRLSTQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNSISVPIASTSD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: PERI; PLIN
Target Alternative Name: Perilipin-1
Host or Source: Mouse
Protein Name: Perilipin 1
WB Description: Fail (Hep G2, Mouse Kidney)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Perilipin-1 Antibody?

The catalog number for Perilipin-1 Antibody is KC-1754.

What sizes are available for Perilipin-1 Antibody?

Perilipin-1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Perilipin-1 Antibody come in?

Perilipin-1 Antibody is available in 3 different pack sizes.

Is Perilipin-1 Antibody in stock?

Perilipin-1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

All Products