TNFRSF13C Antibody

Catalog number KC-2283-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2283-01

Size / count 50 μL

Specifications

Catalog number: KC-2283-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Tumor necrosis factor receptor superfamily member 13C, B-cell-activating factor receptor, BAFF receptor, BAFF-R, BLyS receptor 3, CD antigen CD268
Gene Name: TNFRSF13C
Gene ID: 115650
UniProt: Q96RJ3
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TNFRSF13C
Target Antigen: CD268
Target: PQ-109
Partner Proteins: Tumor necrosis factor receptor superfamily member 13C; B-cell-activating factor receptor; BAFF receptor; BAFF-R; BLyS receptor 3; CD antigen CD268
Clone: K1E043_3D8
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 55%, Pig - 72%, Cynomolgus monkey - 82%
Purity: ≥85%
Cores: RDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 55%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: BAFFR; BR3
Target Alternative Name: TNFRSF13C
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: TNF receptor superfamily member 13C
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for TNFRSF13C Antibody?

The catalog number for TNFRSF13C Antibody is KC-2283.

What sizes are available for TNFRSF13C Antibody?

TNFRSF13C Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does TNFRSF13C Antibody come in?

TNFRSF13C Antibody is available in 3 different pack sizes.

Is TNFRSF13C Antibody in stock?

TNFRSF13C Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

All Products