Sterol carrier 2 Antibody — image 1 of 2

Product details

Sterol carrier 2 Antibody

Catalog number KC-2668-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2668-01

Size / count 50 μL

Specifications

Catalog number: KC-2668-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Sterol carrier protein 2, SCP-2, Acetyl-CoA C-myristoyltransferase, Non-specific lipid-transfer protein, NSL-TP, Propanoyl-CoA C-acyltransferase, SCP-2/3-oxoacyl-CoA thiolase, SCP-2/thiolase, SCP-chi, SCPX, Sterol carrier protein X, SCP-X
Gene Name: SCP2
Gene ID: 6342
UniProt: P22307
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant human SCP2
Target: PP-1481
Partner Proteins: Sterol carrier protein 2; SCP-2; Acetyl-CoA C-myristoyltransferase; Non-specific lipid-transfer protein; NSL-TP; Propanoyl-CoA C-acyltransferase; SCP-2/3-oxoacyl-CoA thiolase; SCP-2/thiolase; SCP-chi; SCPX; Sterol carrier protein X; SCP-X
Clone: K1E050_17A12
Conjugation: Unconjugated
Applications: Top_IHC&Top_IP/ChIP
Validation: Top_IHC&Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 89%, Rat - 87%, Pig - 85%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: LRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQACVGYVFGDSTCGQRAIYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCYEKSGLTPNDIDVIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 89%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Sterol carrier 2
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: Sterol carrier protein 2
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Sterol carrier 2 Antibody?

The catalog number for Sterol carrier 2 Antibody is KC-2668.

What sizes are available for Sterol carrier 2 Antibody?

Sterol carrier 2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Sterol carrier 2 Antibody come in?

Sterol carrier 2 Antibody is available in 3 different pack sizes.

Is Sterol carrier 2 Antibody in stock?

Sterol carrier 2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.