RuvB Like 1 Antibody

Catalog number KC-2977-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2977-01

Size / count 50 μL

Specifications

Catalog number: KC-2977-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: RuvB-like 1, 49 kDa TATA box-binding protein-interacting protein, 49 kDa TBP-interacting protein, 54 kDa erythrocyte cytosolic protein, ECP-54, INO80 complex subunit H, Nuclear matrix protein 238, NMP 238, Pontin 52, TIP49a, TIP60-associated protein 54-alpha, TAP54-alpha
Gene Name: RUVBL1
Gene ID: 8607
UniProt: Q9Y265
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant human RUVBL1
Target: PP-440
Partner Proteins: RuvB-like 1; 49 kDa TATA box-binding protein-interacting protein; 49 kDa TBP-interacting protein; 54 kDa erythrocyte cytosolic protein; ECP-54; INO80 complex subunit H; Nuclear matrix protein 238; NMP 238; Pontin 52; TIP49a; TIP60-associated protein 54-alpha; TAP54-alpha
Clone: K1E056_6C7
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: YEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLF
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: INO80H; NMP238; TIP49; TIP49A
Target Alternative Name: RuvB Like 1
Panel Description: DNA binding & Chromatin
Host or Source: Mouse
Protein Name: RuvB like AAA ATPase 1
WB Description: Succeed
IP description: Fail (Mouse Testis)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for RuvB Like 1 Antibody?

The catalog number for RuvB Like 1 Antibody is KC-2977.

What sizes are available for RuvB Like 1 Antibody?

RuvB Like 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does RuvB Like 1 Antibody come in?

RuvB Like 1 Antibody is available in 3 different pack sizes.

Is RuvB Like 1 Antibody in stock?

RuvB Like 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.