Metalloproteinase Inhibitor 1 Antibody

Catalog number KC-3129-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-3129-01

Size / count 50 μL

Specifications

Catalog number: KC-3129-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Metalloproteinase inhibitor 1, Erythroid-potentiating activity, EPA, Fibroblast collagenase inhibitor, Collagenase inhibitor, Tissue inhibitor of metalloproteinases 1, TIMP-1
Gene Name: TIMP1
Gene ID: 7076
UniProt: P01033
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TIMP1
Target: PQ-243
Partner Proteins: Metalloproteinase inhibitor 1; Erythroid-potentiating activity; EPA; Fibroblast collagenase inhibitor; Collagenase inhibitor; Tissue inhibitor of metalloproteinases 1; TIMP-1
Clone: K1E063_16H7
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 74%, Rat - 72%, Pig - 83%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 74%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CLGI; TIMP
Target Alternative Name: Metalloproteinase Inhibitor 1
Panel Description: Cytokines, Ferroptosis
Host or Source: Mouse
Protein Name: TIMP metallopeptidase inhibitor 1
IHC description: Succeed
IP description: Fail (HT-29)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Metalloproteinase Inhibitor 1 Antibody?

The catalog number for Metalloproteinase Inhibitor 1 Antibody is KC-3129.

What sizes are available for Metalloproteinase Inhibitor 1 Antibody?

Metalloproteinase Inhibitor 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Metalloproteinase Inhibitor 1 Antibody come in?

Metalloproteinase Inhibitor 1 Antibody is available in 3 different pack sizes.

Is Metalloproteinase Inhibitor 1 Antibody in stock?

Metalloproteinase Inhibitor 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.