ZNF252P-AS1 Antibody

Catalog number KC-3204-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-3204-01

Size / count 50 μL

Specifications

Catalog number: KC-3204-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Putative uncharacterized protein ZNF252P-AS1, ZNF252P antisense RNA 1, ZNF252P antisense gene protein 1
Gene Name: ZNF252P-AS1
Gene ID: 286103
UniProt: Q0IIN9
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ZNF252P-AS1
Target: PP-9930
Partner Proteins: Putative uncharacterized protein ZNF252P-AS1; ZNF252P antisense RNA 1; ZNF252P antisense gene protein 1
Clone: K1H008_14C5
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Purity: ≥85%
Cores: SPPLEGCCHRLNEEAEVQRGFRPIAVELEFENQPLGAETRLRNGRRAGVKRSEGRGQVRPGQVRSTGPEGGLTRMERKAARLQWDSGSIK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: C8orf77
Target Alternative Name: ZNF252P-AS1
Host or Source: Mouse
Protein Name: ZNF252P antisense RNA 1
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for ZNF252P-AS1 Antibody?

The catalog number for ZNF252P-AS1 Antibody is KC-3204.

What sizes are available for ZNF252P-AS1 Antibody?

ZNF252P-AS1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does ZNF252P-AS1 Antibody come in?

ZNF252P-AS1 Antibody is available in 3 different pack sizes.

Is ZNF252P-AS1 Antibody in stock?

ZNF252P-AS1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.