MMP13 Antibody (HRP)

Catalog number KH-2693-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-2693-01

Size / count 50 μL

Specifications

Catalog number: KH-2693-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Collagenase 3, Matrix metalloproteinase-13, MMP-13
Gene Name: MMP13
Gene ID: 4322
UniProt: P45452
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human MMP13
Target: PP-295
Partner Proteins: Collagenase 3; Matrix metalloproteinase-13; MMP-13
Clone: K1L001_16A6
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Rat - 85%, Pig - 89%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: DILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: MMP13
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: Matrix metallopeptidase 13
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for MMP13 Antibody (HRP)?

The catalog number for MMP13 Antibody (HRP) is KH-2693.

What sizes are available for MMP13 Antibody (HRP)?

MMP13 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does MMP13 Antibody (HRP) come in?

MMP13 Antibody (HRP) is available in 3 different pack sizes.

Is MMP13 Antibody (HRP) in stock?

MMP13 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

All Products