MMP13 Antibody (HRP)

Catalog number KH-2694-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-2694-01

Size / count 50 μL

Specifications

Catalog number: KH-2694-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Collagenase 3, Matrix metalloproteinase-13, MMP-13
Gene Name: MMP13
Gene ID: 4322
UniProt: P45452
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human MMP13
Target: PP-295
Partner Proteins: Collagenase 3; Matrix metalloproteinase-13; MMP-13
Clone: K1L001_19F5
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Rat - 85%, Pig - 89%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: DILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: MMP13
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: Matrix metallopeptidase 13
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for MMP13 Antibody (HRP)?

The catalog number for MMP13 Antibody (HRP) is KH-2694.

What sizes are available for MMP13 Antibody (HRP)?

MMP13 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does MMP13 Antibody (HRP) come in?

MMP13 Antibody (HRP) is available in 3 different pack sizes.

Is MMP13 Antibody (HRP) in stock?

MMP13 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.